Cilp1 antibody
Web(A06239) Anti-CILP1 Antibody (A06239) Supplier Boster Biological Technology. Host Rabbit View Product On Supplier's Website. Add to Procurement List Product is on your procurement list. View List. Remove. View more details on the supplier's website. Supplier provided information. Validations. None provided. Applications. WebOur CILP polyclonal antibodies are developed in Goat and Rabbit. Find the CILP antibody that fits your needs. Choose from 1 of 4 CILP antibodies, which have been validated in …
Cilp1 antibody
Did you know?
WebCILP-1 HsT18872 Background Major alterations in the composition of the cartilage extracellular matrix occur in joint disease, such as osteoarthrosis. This gene encodes the cartilage intermediate layer protein (CILP), which increases in early osteoarthrosis cartilage. WebNov 18, 2008 · The synthesis of cartilage intermediate layer protein (CILP), which was identified and purified from human articular cartilage ( Lorenzo et al., 1998 ), increases in early osteoarthrosis cartilage. By RT-PCR using human articular cartilage RNA and degenerate primers based on the amino acid sequence of CILP, and by screening a …
WebAntibody [NBP1-81667] CILP-1 Antibody by Novus Biologicals. Menu Sign in or Register Search; Custom Suppliers; Data; Citations; Images; Listing; Contact; ... O75339 - CILP1_HUMAN. Gene CILP Modification Unmodified View Product On Supplier's Website Request a Quote from Novus Biologicals. WebCILP-1 is a pro-form of two polypeptides, and is cleaved into distinct N- and C-terminal fragments at a furin endoprotease consensussite(7).TheN-terminalofCILP-1hasbeenshownto bind to and inhibit TGF 1in vitro(8), andCILP1mRNA is induced by TGF 1 (9).
WebJan 15, 2024 · Background. CILP, Cartilage Intermediate Layer Protein, is specifically expressed in the articular cartilage intermediate layer (it cannot be found in the … Web购物车里没有产品. Anti-MHC Class II Antibody [6C6] (ab55152) 产品货号 产品
WebPresident Trump commented on the possibility of a "COVID 4" relief bill and his desire to invest in the country's infrastructure.
WebProduct Details. This Human CILP ELISA Kit was designed for the quantitative measurement of Human CILP protein in serum, plasma, tissue homogenates. It is a … how fast can termites eat your houseWebThe CILP-1 (cartilage intermediate-layer protein 1) gene product is a 132 kDa (predicted) monomeric glycoprotein that is found in both hyaline and fibrocartilage. It is a precursor for two secreted, proteolytically generated products, a 90 kDa N-terminal CILP-1, and a 62 kDa C-terminal NTPPHase-homolog. high crime areas in buffalo nyWebCited in 1 publication. View Human CILP-1 N-Terminal Fragment Antibody (AF5504) validated in Human & Simple Western, Western Blot from R&D Systems, Inc. a Bio-Techne Brand. how fast can swifts flyWebJun 1, 2024 · Cilp1 polyclonal antibody was raised in rabbits against a synthetic peptide (RQTMLAQSVRRVQPVKRTPKTLAKPADSQE) corresponding to preproCILP1 22-51, after conjugating with keyhole limpet hemocyanin via its C-terminal cysteine. Antibodies for immunofluorescence staining of 4′, 6-diamidino-2-phenylindole (DAPI) and alpha-smooth … how fast can termites do damageWebCD74, also known as CLIP, is a 33.5kD homotrimer and functions as a MHC class II chaperone for exogenous peptides and other MHC class II molecules. CD74 binds MIF and regulates innate and adaptive immunity through CD44 signaling. It is found primarily on B-cells, monocytes, macrophages and dendritic high crime areas in charlotte ncWebPolyclonal Antibody for studying CLIP1/CLIP170. Cited in 5 publications. Validated for Western Blotting. Highly specific and rigorously validated in-house, CLIP1/CLIP170 Antibody (CST #8977) is ready to ship. how fast can steve runWebBackground: CILP-1 The CILP-1 (cartilage intermediate-layer protein 1) gene product is a monomeric glycoprotein precursor of two secreted, proteolytically generated products, a 90 kDa N-terminal CILP-1, and a 62 kDa C-terminal NTPPHase-homolog. It is found in both hyaline and fibrocartilage. how fast can tesla model 3 charge